PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0085s0430.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 311aa    MW: 35705.4 Da    PI: 8.7318
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0085s0430.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1561.6e-48321602128
                     NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                              pGfrFhPtdeelv +yL++ v++k+l++ e ik+vdiyk++PwdLpk  + ++ke yfF++r +ky+++ r+nr+t sg+Wkatg 
  SapurV1A.0085s0430.1.p  32 LPGFRFHPTDEELVGFYLRRMVDKKPLKF-ELIKQVDIYKYDPWDLPKPSSVGDKEGYFFCRRGRKYRNSIRPNRVTGSGFWKATGI 117
                             59**************************9.99***************8777899********************************* PP

                     NAM  89 dkevlskkgel...vglkktLvfykgrapkgektdWvmheyrl 128
                             dk+v+s +ge+   +glkktLv+y+g+a kg+ktdW+mhe+rl
  SapurV1A.0085s0430.1.p 118 DKPVYSLEGEArdcIGLKKTLVYYRGSAGKGTKTDWMMHEFRL 160
                             ******85555566***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100552.07731192IPR003441NAC domain
SuperFamilySSF1019411.7E-5331192IPR003441NAC domain
PfamPF023651.8E-2433160IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MVEKIIDMNN SQGHMRSTSY KDKDDDEEEV QLPGFRFHPT DEELVGFYLR RMVDKKPLKF  60
ELIKQVDIYK YDPWDLPKPS SVGDKEGYFF CRRGRKYRNS IRPNRVTGSG FWKATGIDKP  120
VYSLEGEARD CIGLKKTLVY YRGSAGKGTK TDWMMHEFRL PTTDNSTSAA TVNAKISDQE  180
AEVWTLCRIF KRNVSYKKYT PDLKQLSTKR QQPPIDTSSK KFYQVESSYT QESYVNFGAP  240
LIQHYDNKPL VNLVKERKPL HVGHSSYVAQ PPSMASSLNI SNPYGNEILT QGEWDELSSV  300
VECALDPFLM *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-463319819171NO APICAL MERISTEM PROTEIN
1ut4_B1e-463319819171NO APICAL MERISTEM PROTEIN
1ut7_A1e-463319819171NO APICAL MERISTEM PROTEIN
1ut7_B1e-463319819171NO APICAL MERISTEM PROTEIN
4dul_A1e-463319819171NAC domain-containing protein 19
4dul_B1e-463319819171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002306415.10.0hypothetical protein POPTR_0005s10080g
SwissprotQ9SK554e-89NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBLB9H6380.0B9H638_POPTR; Uncharacterized protein
STRINGPOPTR_0005s10080.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101334112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43000.12e-90NAC domain containing protein 42